ADHFE1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A25256
Article Name: ADHFE1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A25256
Supplier Catalog Number: A25256
Alternative Catalog Number: ABB-A25256-20UL,ABB-A25256-100UL,ABB-A25256-1000UL,ABB-A25256-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: HOT, ADH8, HMFT2263
The ADHFE1 gene encodes hydroxyacid-oxoacid transhydrogenase (EC 1.1.99.24), which is responsible for the oxidation of 4-hydroxybutyrate in mammalian tissues (Kardon et al., 2006 [PubMed 16616524]).
Clonality: Polyclonal
Molecular Weight: 50kDa
NCBI: 137872
UniProt: Q8IWW8
Purity: Affinity purification
Sequence: KTTDYAFEMAVSNIRYGAAVTKEVGMDLKNMGAKNVCLMTDKNLSKLPPVQVAMDSLVKNGIPFTVYDNVRVEPTDSSFMEAIEFAQKGAFDAYVAVGGGSTMDTCKAANLYASSPHSDFLDYVSAPIGKGKPVSVPLKPLIAVPTTSGTGSETTGVAIFDYEHLKVKIGITSRAIKPTLGLIDPLHTLHMPARVVANSGFDVLCHALESYTTLP
Target: ADHFE1
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Mouse. ResearchArea: Signal Transduction,Metabolism,Alcohol metabolism. Shipping: Ice Bag
Western blot analysis of lysates from Mouse heart usingADHFE1 Rabbit pAb (A25256) at1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.