MLYCD Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: MLYCD Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A25258
• Supplier Catalog Number: A25258
• Alternative Catalog Number: ABB-A25258-100UL,ABB-A25258-20UL,ABB-A25258-1000UL,ABB-A25258-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: MCD, MLYCD

Product Description

The product of this gene catalyzes the breakdown of malonyl-CoA to acetyl-CoA and carbon dioxide. Malonyl-CoA is an intermediate in fatty acid biosynthesis, and also inhibits the transport of fatty acyl CoAs into mitochondria. Consequently, the encoded protein acts to increase the rate of fatty acid oxidation. It is found in mitochondria, peroxisomes, and the cytoplasm. Mutations in this gene result in malonyl-CoA decarboyxlase deficiency.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 55kDa
• NCBI: 23417
• UniProt: O95822
• Purity: Affinity purification
• Sequence: MDELLRRAVPPTPAYELREKTPAPAEGQCADFVSFYGGLAETAQRAELLGRLARGFGVDHGQVAEQSAGVLHLRQQQREAAVLLQAEDRLRYALVPRYRGLFHHISKLDGGVRFLVQLRADLLEAQALKLVEGPDVREMNGVLKGMLSEWF
• Target: MLYCD
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Mouse,Rat. ResearchArea: Cancer,Signal Transduction,Endocrine Metabolism,Lipid Metabolism,Cardiovascular,Lipids,Fatty Acids. Shipping: Ice Bag

Images

Western blot analysis of various lysates using MLYCD Rabbit pAb (A25258) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates / proteins: 25 µg per lane.
Blocking buffer: 3 % nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time:60s.