[KD Validated] LXR beta/NER Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: [KD Validated] LXR beta/NER Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A25259
• Supplier Catalog Number: A25259
• Alternative Catalog Number: ABB-A25259-20UL,ABB-A25259-1000UL,ABB-A25259-100UL,ABB-A25259-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: NER, UNR, LXRB, LXR-b, NER-I, RIP15, NR1H2

Product Description

The liver X receptors, LXRA (NR1H3, MIM 602423) and LXRB, form a subfamily of the nuclear receptor superfamily and are key regulators of macrophage function, controlling transcriptional programs involved in lipid homeostasis and inflammation. The inducible LXRA is highly expressed in liver, adrenal gland, intestine, adipose tissue, macrophages, lung, and kidney, whereas LXRB is ubiquitously expressed. Ligand-activated LXRs form obligate heterodimers with retinoid X receptors (RXRs, see MIM 180245) and regulate expression of target genes containing LXR response elements (summary by Korf et al., 2009 [PubMed 19436111]).

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 51kDa
• NCBI: 7376
• UniProt: P55055
• Purity: Affinity purification
• Sequence: MSSPTTSSLDTPLPGNGPPQPGAPSSSPTVKEEGPEPWPGGPDPDVPGTDEASSACSTDWVIPDPEEEPERKRKKGPAPKMLGHELCRVCGDKASGFHYN
• Target: NR1H2

Application Notes

• Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Nuclear Receptor Signaling,Cancer,Endocrine Metabolism,Lipid Metabolism,Cholesterol Metabolism,Cardiovascular,Lipids. Shipping: Ice Bag

Images

Western blot analysis of lysates from wild type (WT) and LXR beta/NER knockdown (KD)HeLa cellsusing[KD Validated] LXR beta/NER Rabbit pAb (A25259) at1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time:60s.