GJA4 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: GJA4 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A2529
• Supplier Catalog Number: A2529
• Alternative Catalog Number: ABB-A2529-20UL,ABB-A2529-100UL,ABB-A2529-1000UL,ABB-A2529-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: CX37, GJA4

Product Description

This gene encodes a member of the connexin gene family. The encoded protein is a component of gap junctions, which are composed of arrays of intercellular channels that provide a route for the diffusion of low molecular weight materials from cell to cell. Mutations in this gene have been associated with atherosclerosis and a higher risk of myocardial infarction.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 37kDa
• NCBI: 2701
• UniProt: P35212
• Purity: Affinity purification
• Sequence: VHLLCRCLSRGMRARQGQDAPPTQGTSSDPYTDQVFFYLPVGQGPSSPPCPTYNGLSSSEQNWANLTTEERLASSRPPLFLDPPPQNGQKPPSRPSSSASKKQYV
• Target: GJA4
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Rat. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cell Adhesion,Cytoskeleton,Immunology Inflammation,Cardiovascular. Shipping: Ice Bag

Images

Western blot analysis of lysates from Rat liver usingGJA4 Rabbit pAb (A2529) at1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.