GnRH1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A25429
Article Name: GnRH1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A25429
Supplier Catalog Number: A25429
Alternative Catalog Number: ABB-A25429-100UL,ABB-A25429-500UL,ABB-A25429-20UL,ABB-A25429-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: GRH, GNRH, LHRH, LNRH
This gene encodes a preproprotein that is proteolytically processed to generate a peptide that is a member of the gonadotropin-releasing hormone (GnRH) family of peptides. Alternative splicing results in multiple transcript variants, at least one of which is secreted and then cleaved to generate gonadoliberin-1 and GnRH-associated peptide 1. Gonadoliberin-1 stimulates the release of luteinizing and follicle stimulating hormones, which are important for reproduction. Mutations in this gene are associated with hypogonadotropic hypogonadism.
Clonality: Polyclonal
Molecular Weight: 10kDa
NCBI: 2796
UniProt: P01148
Purity: Affinity purification
Sequence: MKPIQKLLAGLILLTWCVEGCSSQHWSYGLRPGGKRDAENLIDSFQEIVKEVGQLAETQRFECTTHQPRSPLRDLKGALESLIEEETGQKKI
Target: GNRH1
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Mouse. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Growth factors. Shipping: Ice Bag
Western blot analysis of lysates from wild type (WT) and293T cells transfected withGnRH1 usingGnRH1 Rabbit pAb (A25429) at1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time:60s.