PPIF Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: PPIF Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A25436
• Supplier Catalog Number: A25436
• Alternative Catalog Number: ABB-A25436-20UL,ABB-A25436-500UL,ABB-A25436-1000UL,ABB-A25436-100UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: CYP3, CypD, CyP-M, Cyp-D

Product Description

The protein encoded by this gene is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein is part of the mitochondrial permeability transition pore in the inner mitochondrial membrane. Activation of this pore is thought to be involved in the induction of apoptotic and necrotic cell death.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 22kDa
• NCBI: 10105
• UniProt: P30405
• Purity: Affinity purification
• Sequence: CSKGSGDPSSSSSSGNPLVYLDVDANGKPLGRVVLELKADVVPKTAENFRALCTGEKGFGYKGSTFHRVIPSFMCQAGDFTNHNGTGGKSIYGSRFPDENFTLKHVGPGVLSMANAGPNTNGSQFFICTIKTDWLDGKHVVFGHVKEGMDVVKKIESFGSKSGRTSKKIVITDCGQLS
• Target: PPIF

Application Notes

• Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Mouse. ResearchArea: Cancer,Signal Transduction,Cell Biology Developmental Biology,Apoptosis,Endocrine Metabolism,Mitochondrial metabolism,Mitochondrial markers. Shipping: Ice Bag

Images

Western blot analysis of lysates from Mouse heart usingPPIF Rabbit pAb (A25436) at1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time:15s.