ZIP8 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: ZIP8 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A25602
• Supplier Catalog Number: A25602
• Alternative Catalog Number: ABB-A25602-500UL,ABB-A25602-20UL,ABB-A25602-100UL,ABB-A25602-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: ZIP8, CDG2N, PP3105, BIGM103, LZT-Hs6

Product Description

This gene encodes a member of the SLC39 family of solute-carrier genes, which show structural characteristics of zinc transporters. The encoded protein is glycosylated and found in the plasma membrane and mitochondria, and functions in the cellular import of zinc at the onset of inflammation. It is also thought to be the primary transporter of the toxic cation cadmium, which is found in cigarette smoke. Multiple transcript variants encoding different isoforms have been found for this gene. Additional alternatively spliced transcript variants of this gene have been described, but their full-length nature is not known.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 50kDa
• NCBI: 64116
• UniProt: Q9C0K1
• Purity: Affinity purification
• Sequence: AVFGGFYLLFFFERMLKMLLKTYGQNGHTHFGNDNFGPQEKTHQPKALPAINGVTCYANPAVTEANGHIHFDNVSVVSLQDGKKEPSSCTCLKGPKLSEI
• Target: SLC39A8

Application Notes

• Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Cancer,Signal Transduction,Cell Biology Developmental Biology,Cell Cycle,Cell differentiation,Endocrine Metabolism,Lipid Metabolism. Shipping: Ice Bag

Images

Western blot analysis of lysates from Rat kidney usingZIP8 Rabbit pAb (A25602) at1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time:30s.