14-3-3 Theta Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: 14-3-3 Theta Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A2563
• Supplier Catalog Number: A2563
• Alternative Catalog Number: ABB-A2563-20UL,ABB-A2563-500UL,ABB-A2563-100UL,ABB-A2563-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: 1C5, HS1, 14-3-3, 14-3-3 Theta

Product Description

This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse and rat orthologs. This gene is upregulated in patients with amyotrophic lateral sclerosis. It contains in its 5 UTR a 6 bp tandem repeat sequence which is polymorphic, however, there is no correlation between the repeat number and the disease.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 28kDa
• NCBI: 10971
• UniProt: P27348
• Purity: Affinity purification
• Sequence: KNVVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLKMKGDYFRYLAEVACGDDRKQTIDNSQGAY
• Target: YWHAQ
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Signal Transduction,PI3K-Akt Signaling Pathway,MAPK-Erk Signaling Pathway,MAPK-JNK Signaling Pathway,Cell Biology Developmental Biology,Apoptosis,Mitochondrial Control of Apoptosis,Cell Cycle,Cell Cycle Control-G2 M DNA Damage Checkpoint,Neuroscience, Cell Type Marker,Stem Cells,Neuron marker,Synapse marker. Shipping: Ice Bag

Images

Western blot analysis of various lysates using 14-3-3 Theta Rabbit pAb (A2563) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.