SUMO2/3 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: SUMO2/3 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A2571
• Supplier Catalog Number: A2571
• Alternative Catalog Number: ABB-A2571-500UL,ABB-A2571-100UL,ABB-A2571-1000UL,ABB-A2571-20UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: HSMT3, SMT3B, SUMO3, Smt3A, SMT3H2, SUMO2/3

Product Description

This gene encodes a protein that is a member of the SUMO (small ubiquitin-like modifier) protein family. It functions in a manner similar to ubiquitin in that it is bound to target proteins as part of a post-translational modification system. However, unlike ubiquitin which targets proteins for degradation, this protein is involved in a variety of cellular processes, such as nuclear transport, transcriptional regulation, apoptosis, and protein stability. It is not active until the last two amino acids of the carboxy-terminus have been cleaved off. Numerous pseudogenes have been reported for this gene. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 11 kDa
• NCBI: 6613
• UniProt: P61956
• Purity: Affinity purification
• Sequence: MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVY
• Target: SUMO2
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cell Biology Developmental Biology,Ubiquitin,Endocrine Metabolism,Mitochondrial metabolism,Immunology Inflammation,Jak-Stat-IL-6 Receptor Signaling Pathway,NF-kB Signaling Pathway. Shipping: Ice Bag

Images

Western blot analysis of various lysates using SUMO2/3 Rabbit pAb (A2571) at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.