CCL4 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: CCL4 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A25848
• Supplier Catalog Number: A25848
• Alternative Catalog Number: ABB-A25848-100UL,ABB-A25848-20UL,ABB-A25848-500UL,ABB-A25848-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Mouse
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: Act-2, Mip1b, Scya4, MIP-1B, AT744.1

Product Description

Predicted to enable chemokine receptor binding activity and identical protein binding activity. Acts upstream of or within cellular response to xenobiotic stimulus. Located in extracellular space. Is expressed in central nervous system, genitourinary system, and retina. Human ortholog(s) of this gene implicated in acquired immunodeficiency syndrome and human immunodeficiency virus infectious disease. Orthologous to several human genes including CCL4L2 (C-C motif chemokine ligand 4 like 2).

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 10kDa
• NCBI: 20303
• UniProt: P14097
• Purity: Affinity purification
• Sequence: APMGSDPPTSCCFSYTSRQLHRSFVMDYYETSSLCSKPAVVFLTKRGRQICANPSEPWVTEYMSDLELN
• Target: CCL4

Application Notes

• Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Mouse. ResearchArea: Immunology Innate Immunity Macrophage / Inflamm.Immunology Innate Immunity Chemokines Beta Chemokines (CC)Kits/ Lysates/ Other Kits ELISA Kits ELISA Kits Cytokines and cytokine receptors ELISA kitsImmunology Immune System Diseases Antiviral Signaling HIV-related. Shipping: Ice Bag

Images

Western blot analysis of lysates from RAW 264.7 cells using CCL4 Rabbit pAb (A25848) at 1:1000 dilutionincubated overnight at 4°C. Raw264.7 cells were treated by PMA (80 nM) at 37°C for overnight and LPS (1 µg/ml) at 37°C for 6 hours and Brefeldin A for 3 hours of stimulation.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 30 µg per lane.
Blocking buffer: 3 % nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.