MUSK Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: MUSK Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A2591
• Supplier Catalog Number: A2591
• Alternative Catalog Number: ABB-A2591-100UL,ABB-A2591-20UL,ABB-A2591-1000UL,ABB-A2591-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: CMS9, FADS, FADS1, MUSK

Product Description

This gene encodes a muscle-specific tyrosine kinase receptor. The encoded protein may play a role in clustering of the acetylcholine receptor in the postsynaptic neuromuscular junction. Mutations in this gene have been associated with congenital myasthenic syndrome. Alternatively spliced transcript variants have been described.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 97kDa
• NCBI: 4593
• UniProt: O15146
• Purity: Affinity purification
• Sequence: LTITTLYCCRRRKQWKNKKRESAAVTLTTLPSELLLDRLHPNPMYQRMPLLLNPKLLSLEYPRNNIEYVRDIGEGAFGRVFQARAPGLLPYEPFTMVAVKMLKEEASADMQADFQREAALMAEFDNPNIVKLLGVCAVGKPMCLLFEYMAYGDLNEFLRSMSPHTVCSLSHSDLSMRAQVSSPGPPPLSCAEQLCIARQVAAGMAYLSERKFVHRDLATRNCLVGENMVVKIADFGLSRNIYSADYYKANENDAI
• Target: MUSK
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:100 - 1:500|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Mouse. ResearchArea: Signal Transduction,Kinase,Tyrosine kinases,Cell Biology Developmental Biology,Cytoskeleton,Extracellular Matrix,Bone. Shipping: Ice Bag

Images

Western blot analysis of lysates from Mouse skeletal muscle, using MUSK Rabbit pAb (A2591) at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.