Cleaved PARP1 p25 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: Cleaved PARP1 p25 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A26155
• Supplier Catalog Number: A26155
• Alternative Catalog Number: ABB-A26155-100UL,ABB-A26155-20UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: PARP, PARS, PPOL, ADPRT, ARTD1, ADPRT1, PARP-1, ADPRT 1, pADPRT-1, Poly-PARP

Product Description

This gene encodes a chromatin-associated enzyme, poly(ADP-ribosyl)transferase, which modifies various nuclear proteins by poly(ADP-ribosyl)ation. The modification is dependent on DNA and is involved in the regulation of various important cellular processes such as differentiation, proliferation, and tumor transformation and also in the regulation of the molecular events involved in the recovery of cell from DNA damage. In addition, this enzyme may be the site of mutation in Fanconi anemia, and may participate in the pathophysiology of type I diabetes.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 113kDa
• NCBI: 142
• UniProt: P09874
• Purity: Affinity purification
• Sequence: GVKSEGKRKGDEVDGVDEVAKKKSKKEKDKDSKLEKALKAQNDLIWNIKDELKKVCSTNDLKELLIFNKQQVPSGESAILDRVADGMVFGALLPCEECSG
• Target: PARP1

Application Notes

• Application Dilute: WB,1:1000 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling,Epigenetic writers and erasers of core Histones,DNA Damage Repair,RNA Binding,Signal Transduction,Cell Biology Developmental Biology,Cell Cycle,Centrosome,Death Receptor Signaling Pathway,Immunology Inflammation,NF-kB Signaling Pathway. Shipping: Ice Bag

Images

Western blot analysis of lysates from Jurkat cells using Cleaved PARP1 p25 Rabbit pAb (A26155) at 1:1000 dilutionincubated overnight at 4°C. Jurkat cells were treated by Etoposide (25 uM) at 37°C for 5 hours.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 30 µg per lane.
Blocking buffer: 3 % nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.