[KD Validated] HSP90B1 Rabbit mAb, Unconjugated

Product Overview

• Article Name: [KD Validated] HSP90B1 Rabbit mAb, Unconjugated
• Biozol Catalog Number: ABB-A26311
• Supplier Catalog Number: A26311
• Alternative Catalog Number: ABB-A26311-1000UL,ABB-A26311-500UL,ABB-A26311-100UL,ABB-A26311-20UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, IHC-P, WB
• Species Reactivity: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: ECGP, GP96, TRA1, GRP94, HEL35, HEL-S-125m

Product Description

This gene encodes a member of a family of adenosine triphosphate(ATP)-metabolizing molecular chaperones with roles in stabilizing and folding other proteins. The encoded protein is localized to melanosomes and the endoplasmic reticulum. Expression of this protein is associated with a variety of pathogenic states, including tumor formation. There is a microRNA gene located within the 5 exon of this gene. There are pseudogenes for this gene on chromosomes 1 and 15.

Product Properties

• Molecular Weight: 92kDa
• NCBI: 7184
• UniProt: P14625
• Purity: Affinity purification
• Sequence: EPLLNWMKDKALKDKIEKAVVSQRLTESPCALVASQYGWSGNMERIMKAQAYQTGKDISTNYYASQKKTFEINPRHPLIRDMLRRIKEDEDDKTVLDLAV
• Target: HSP90B1

Application Notes

• Application Dilute: WB,1:1000 - 1:4000|IHC-P,1:200 - 1:800|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Cancer,Signal Transduction,Cell Biology Developmental Biology,Apoptosis,Endocrine Metabolism.

Images

Western blot analysis of various lysates using [KD Validated] HSP90B1 Rabbit mAb (A26311) at 1:2000 dilution incubated overnight at 4°C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

Western blot analysis of various lysates using [KD Validated] HSP90B1 Rabbit mAb (A26311) at 1:2000 dilution incubated overnight at 4°C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

Western blot analysis of lysates from wild type (WT) and HSP90B1 knockdown (KD) HeLa cells using [KD Validated] HSP90B1 Rabbit mAb (A26311) at 1:2000 dilution incubated overnight at 4°C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 20s.

Immunohistochemistry analysis of paraffin-embedded Human cervix cancer tissue using [KD Validated] HSP90B1 Rabbit mAb (A26311) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human liver tissue using [KD Validated] HSP90B1 Rabbit mAb (A26311) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Mouse brain tissue using [KD Validated] HSP90B1 Rabbit mAb (A26311) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Mouse testis tissue using [KD Validated] HSP90B1 Rabbit mAb (A26311) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Rat brain tissue using [KD Validated] HSP90B1 Rabbit mAb (A26311) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Rat liver tissue using [KD Validated] HSP90B1 Rabbit mAb (A26311) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.