CaSR Rabbit mAb, Unconjugated

Catalog Number: ABB-A26435
Article Name: CaSR Rabbit mAb, Unconjugated
Biozol Catalog Number: ABB-A26435
Supplier Catalog Number: A26435
Alternative Catalog Number: ABB-A26435-100UL,ABB-A26435-20UL,ABB-A26435-500UL,ABB-A26435-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, IHC-P, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: CAR, FHH, FIH, HHC, EIG8, HHC1, NSHPT, PCAR1, hCasR, GPRC2A, HYPOC1
The protein encoded by this gene is a plasma membrane G protein-coupled receptor that senses small changes in circulating calcium concentration. The encoded protein couples this information to intracellular signaling pathways that modify parathyroid hormone secretion or renal cation handling, and thus this protein plays an essential role in maintaining mineral ion homeostasis. Mutations in this gene are a cause of familial hypocalciuric hypercalcemia, neonatal severe hyperparathyroidism, and autosomal dominant hypocalcemia.
Molecular Weight: 121kDa
NCBI: 846
UniProt: P41180
Purity: Affinity purification
Sequence: TIAADDDYGRPGIEKFREEAEERDICIDFSELISQYSDEEEIQHVVEVIQNSTAKVIVVFSSGPDLEPLIKEIVRRNITGKIWLASEAWASSSLIAMPQY
Target: CASR
Application Dilute: WB,1:2000 - 1:6000|IF-P,1:50 - 1:200|IHC-P,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Cancer,Signal Transduction,G protein signaling,G-Protein-Coupled ReceptorsGPCR,Cell Biology Developmental Biology,Cytoskeleton,Extracellular Matrix,Bone,Growth factors,Endocrine Metabolism,Neuroscience,Calcium Signaling.
Immunohistochemistry analysis of paraffin-embedded Rat kidney tissue using CaSR Rabbit mAb (A26435) at a dilution of 1:800 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Mouse kidney tissue using CaSR Rabbit mAb (A26435) at a dilution of 1:800 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.
Western blot analysis of various lysates using CaSR Rabbit mAb (A26435) at 1:5000 dilution incubated overnight at 4°C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.
Immunohistochemistry analysis of paraffin-embedded Human kidney tissue using CaSR Rabbit mAb (A26435) at a dilution of 1:800 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.
Confocal imaging of paraffin-embedded Rat kidney tissue using CaSR Rabbit mAb (A26435, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IF staining. Objective: 40x.
Confocal imaging of paraffin-embedded Mouse kidney tissue using CaSR Rabbit mAb (A26435, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IF staining. Objective: 40x.
Confocal imaging of paraffin-embedded Human pancreas tissue using CaSR Rabbit mAb (A26435, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IF staining. Objective: 40x.