CCL25 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A2685
Article Name: CCL25 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A2685
Supplier Catalog Number: A2685
Alternative Catalog Number: ABB-A2685-1000UL,ABB-A2685-20UL,ABB-A2685-100UL,ABB-A2685-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: TECK, Ckb15, SCYA25, TECKvar, Ck beta-15, CCL25
This antimicrobial gene belongs to the subfamily of small cytokine CC genes. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity for dendritic cells, thymocytes, and activated macrophages but is inactive on peripheral blood lymphocytes and neutrophils. The product of this gene binds to chemokine receptor CCR9. Alternative splicing results in multiple transcript variants.
Clonality: Polyclonal
Molecular Weight: 17kDa
NCBI: 6370
UniProt: O15444
Purity: Affinity purification
Sequence: QGVFEDCCLAYHYPIGWAVLRRAWTYRIQEVSGSCNLPAAIFYLPKRHRKVCGNPKSREVQRAMKLLDARNKVFAKLHHNTQTFQAGPHAVKKLSSGNSKLSSSKFSNPISSSKRNVSLLISANSGL
Target: CCL25
Antibody Type: Primary Antibody
Application Dilute: WB,1:1000 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human. ResearchArea: Immunology Inflammation,Cytokines,Cell Intrinsic Innate Immunity Signaling Pathway. Shipping: Ice Bag
Western blot analysis of lysates from wild type (WT) and 293T cells transfected with CCL25, using CCL25 Rabbit pAb (A2685) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 0.5s.