SLC23A2 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: SLC23A2 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A26880
• Supplier Catalog Number: A26880
• Alternative Catalog Number: ABB-A26880-20UL,ABB-A26880-500UL,ABB-A26880-1000UL,ABB-A26880-100UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: NBTL1, SVCT2, YSPL2, SLC23A1

Product Description

The absorption of vitamin C into the body and its distribution to organs requires two sodium-dependent vitamin C transporters. This gene encodes one of the two required transporters and the encoded protein accounts for tissue-specific uptake of vitamin C. Previously, this gene had an official symbol of SLC23A1.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 70kDa
• NCBI: 9962
• UniProt: Q9UGH3
• Purity: Affinity purification
• Sequence: NVLLTTAMFVGGCVAFILDNTIPGTPEERGIRKWKKGVGKGNKSLDGMESYNLPFGMNIIKKYRCFSYLPISPTFVGYTWKGLRKSDNSRSSDEDSQATG
• Target: SLC23A2

Application Notes

• Application Dilute: WB,1:2500 - 1:10000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse. Shipping: Ice Bag

Images

Western blot analysis of various lysates using SLC23A2 Rabbit pAb (A26880) at 1:5000 dilution incubated overnight at 4°C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.