[KD Validated] XPNPEP3 Rabbit mAb, Unconjugated

Product Overview

• Article Name: [KD Validated] XPNPEP3 Rabbit mAb, Unconjugated
• Biozol Catalog Number: ABB-A26950
• Supplier Catalog Number: A26950
• Alternative Catalog Number: ABB-A26950-1000UL,ABB-A26950-20UL,ABB-A26950-100UL,ABB-A26950-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, IHC-P, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: APP3, ICP55, NPHPL1

Product Description

The protein encoded by this gene belongs to the family of X-pro-aminopeptidases that utilize a metal cofactor, and remove the N-terminal amino acid from peptides with a proline residue in the penultimate position. This protein has been shown to localize to the mitochondria of renal cells, and have a role in ciliary function. Mutations in this gene are associated with nephronophthisis-like nephropathy-1. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene, however, expression of some of these isoforms in vivo is not known.

Product Properties

• Molecular Weight: 57kDa
• NCBI: 63929
• UniProt: Q9NQH7
• Purity: Affinity purification
• Sequence: SLQPVPERRIPNRYLGQPSPFTHPHLLRPGEVTPGLSQVEYALRRHKLMSLIQKEAQGQSGTDQTVVVLSNPTYYMSNDIPYTFHQDNNFLYLCGFQEPDSILVLQSLPGKQLPSHKAILFVPRRDPSRELWDGPRSGTDGAIALTGVDEAYTLEEFQHLLPKMKAETNMVWYDWMRPSHAQLHSDYMQPLTEAKAKSK
• Target: XPNPEP3

Application Notes

• Application Dilute: WB,1:13000 - 1:78000|IHC-P,1:200 - 1:800|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Signal Transduction,Endocrine Metabolism,Amino acid metabolism.

Images

Western blot analysis of various lysates using [KD Validated] XPNPEP3 Rabbit mAb (A26950) at 1:13000 dilution incubated overnight at 4°C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Immunohistochemistry analysis of paraffin-embedded Human liver cancer tissue using [KD Validated] XPNPEP3 Rabbit mAb (A26950) at a dilution of 1:600 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Western blot analysis of lysates from wild type (WT) and XPNPEP3 knockdown (KD) 293T cells using [KD Validated] XPNPEP3 Rabbit mAb (A26950) at 1:13000 dilution incubated overnight at 4°C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma tissue using [KD Validated] XPNPEP3 Rabbit mAb (A26950) at a dilution of 1:600 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human tonsil tissue using [KD Validated] XPNPEP3 Rabbit mAb (A26950) at a dilution of 1:600 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Rat spleen tissue using [KD Validated] XPNPEP3 Rabbit mAb (A26950) at a dilution of 1:600 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Rat testis tissue using [KD Validated] XPNPEP3 Rabbit mAb (A26950) at a dilution of 1:600 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.