Rab12 Rabbit mAb [MJFF-A-3F6], Unconjugated, Monoclonal

Catalog Number: ABB-A27275
Article Name: Rab12 Rabbit mAb [MJFF-A-3F6], Unconjugated, Monoclonal
Biozol Catalog Number: ABB-A27275
Supplier Catalog Number: A27275
Alternative Catalog Number: ABB-A27275-1000UL,ABB-A27275-100UL,ABB-A27275-500UL,ABB-A27275-20UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IP
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: RAB12
Rab12 is a member of the RAS oncogene family and plays a crucial role in intracellular membrane trafficking. This small GTPase protein is involved in the transport of vesicles, particularly from recycling endosomes to lysosomes, and is essential for processes like autophagy and the degradation of the transferrin receptor. Rab12 cycles between an inactive GDP-bound form and an active GTP-bound form, recruiting various effectors responsible for vesicle formation, movement, and fusion. In addition to being a substrate for phosphorylation by LRRK2 (Leucine-Rich Repeat Kinase 2), Rab12 has recently been identified as its significant regulator. It has been shown that Rab12 can activate LRRK2, leading to increased phosphorylation of Rab10, another protein involved in intracellular trafficking. This activation is particularly notable in the context of lysosomal damage, where Rab12 helps recruit LRRK2 to lysosomes, enhancing its activity. Dysregulation of this pathway due to pathogenic LRRK2 mutations can contribute to the neurodegenerative processes observed in Parkinsons disease.
Clonality: Monoclonal
Molecular Weight: 27kDa
NCBI: 201475
UniProt: Q6IQ22
Purity: Affinity purification
Sequence: MDPGAALQRRAGGGGGLGAGSPALSGGQGRRRKQPPRPADFKLQVIIIGSRGVGKTSLMERFTDDTFCEACKSTVGVDFKIKTVELRGKKIRLQIWDTAGQERFNSITSAYYRSAKGIILVYDITKKETFDDLPKWMKMIDKYASEDAELLLVGNKLDCETDREITRQQGEKFAQQITGMRFCEASAKDNFNVDEIFLKLVDDILKKMPLDILRNELSNSILSLQPEPEIPPELPPPRPHVRCC
Target: RAB12
Application Dilute: IP,0.5µg-4µg antibody for 200µg-400µg extracts of whole cells|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human. ResearchArea: Signal Transduction,G protein signaling,Small G proteins. Shipping: Ice Bag
Immunoprecipitation of Rab12 from 250 µg of extracts of A549 wild-type (WT) or A549 Rab12 knock-out (Rab12 KO) cells was performed using 1.5 µg of Rab12 Rabbit mAb [MJFF-A-3F6] (A27275) conjugated to MyOne(TM) Epoxy Dynabeads. Negative Control IP (Control IgG) was performed using MyOne(TM) Epoxy Dynabeads conjugated with Bovine Serum Albumin. IP samples were eluted with 1X reducing Laemmli Buffer. The Input lane represents 4% of the total input. Western blot analysis of immunoprecipitates was conducted using Rab12 Rabbit mAb [MJFF-A-3F6] (A27275) at a dilution of 1:1000.