DDX4 Rabbit mAb, Unconjugated

Product Overview

• Article Name: DDX4 Rabbit mAb, Unconjugated
• Biozol Catalog Number: ABB-A27291
• Supplier Catalog Number: A27291
• Alternative Catalog Number: ABB-A27291-20UL,ABB-A27291-100UL,ABB-A27291-500UL,ABB-A27291-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, IF, IHC-P, IP, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: VASA

Product Description

DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein, which is a homolog of VASA proteins in Drosophila and several other species. The gene is specifically expressed in the germ cell lineage in both sexes and functions in germ cell development. Multiple transcript variants encoding different isoforms have been found for this gene.

Product Properties

• Molecular Weight: 79kDa
• NCBI: 54514
• UniProt: Q9NQI0
• Purity: Affinity purification
• Sequence: GNTGRAISFFDLESDNHLAQPLVKVLTDAQQDVPAWLEEIAFSTYIPGFSGSTRGNVFASVDTRKGKSTLNTAGFSSSQAPNPVDDESWD
• Target: DDX4

Application Notes

• Application Dilute: WB,1:5000 - 1:30000|IP,0.5µg-4µg antibody for 200µg-400µg extracts of whole cells|IF-P,1:200 - 1:800|IHC-P,1:700 - 1:7000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Epigenetics Nuclear Signaling,Cell Biology Developmental Biology,Stem Cells,Germline Stem Cells.

Images

Immunohistochemistry analysis of paraffin-embedded Mouse testis tissue using DDX4 Rabbit mAb (A27291) at a dilution of 1:7000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Rat testis tissue using DDX4 Rabbit mAb (A27291) at a dilution of 1:7000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Western blot analysis of various lysates using DDX4 Rabbit mAb (A27291) at 1:14000 dilutionincubated overnight at 4°C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Negative control (NC): Mouse brain
Exposure time: 10s.

Immunohistochemistry analysis of paraffin-embedded Human testis tissue using DDX4 Rabbit mAb (A27291) at a dilution of 1:7000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Confocal imaging of paraffin-embedded Mouse testis tissue using DDX4 Rabbit mAb (A27291, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x.

Confocal imaging of paraffin-embedded Rat testis tissue using DDX4 Rabbit mAb (A27291, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x.

Immunoprecipitation of DDX4 from 300 µg extracts of Mouse testis was performed using 0.5 µg of DDX4 Rabbit mAb (A27291). Rabbit IgG isotype control (AC005) was used to precipitate the Control IgG sample. IP samples were eluted with 1X reducing Laemmli Buffer. The Input lane represents 10% of the total input. Western blot analysis of immunoprecipitates was conducted using DDX4 Rabbit mAb (A27291) at a dilution of 1:10000.