PE Rabbit anti-Human TMPRSS2 mAb

Catalog Number: ABB-A27410
Article Name: PE Rabbit anti-Human TMPRSS2 mAb
Biozol Catalog Number: ABB-A27410
Supplier Catalog Number: A27410
Alternative Catalog Number: ABB-A27410-200T,ABB-A27410-100T,ABB-A27410-500T,ABB-A27410-50T
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: PE
Alternative Names: PRSS10
This gene encodes a protein that belongs to the serine protease family. The encoded protein contains a type II transmembrane domain, a receptor class A domain, a scavenger receptor cysteine-rich domain and a protease domain. Serine proteases are known to be involved in many physiological and pathological processes. This gene was demonstrated to be up-regulated by androgenic hormones in prostate cancer cells and down-regulated in androgen-independent prostate cancer tissue. The protease domain of this protein is thought to be cleaved and secreted into cell media after autocleavage. This protein also facilitates entry of viruses into host cells by proteolytically cleaving and activating viral envelope glycoproteins. Viruses found to use this protein for cell entry include Influenza virus and the human coronaviruses HCoV-229E, MERS-CoV, SARS-CoV and SARS-CoV-2 (COVID-19 virus). Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Concentration: FC
Molecular Weight: 54kDa
NCBI: 7113
UniProt: O15393
Purity: Affinity purification
Sequence: WKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENYGRAACRDMGYKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDIYKKLYHSDACSSKAVVSLRCIACGVNLNSSRQSR
Target: TMPRSS2
Application Dilute: FC,5 µl per 10 6 cells in 100 µl volume
Application Notes: Cross-Reactivity: Human, ResearchArea: Cancer,Tumor biomarkers,Cell Biology Developmental Biology,Ubiquitin,Neuroscience,Neurodegenerative Diseases.