Alpha-synuclein Truncation 1-122 mAb [MJFF-D-10B7], Unconjugated, Rabbit, Monoclonal

Product Overview

• Article Name: Alpha-synuclein Truncation 1-122 mAb [MJFF-D-10B7], Unconjugated, Rabbit, Monoclonal
• Biozol Catalog Number: ABB-A27452
• Supplier Catalog Number: A27452
• Alternative Catalog Number: ABB-A27452-500UL,ABB-A27452-100UL,ABB-A27452-1000UL,ABB-A27452-20UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, Slot blot
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: PD1, NACP, PARK1, PARK4

Product Description

Alpha-synuclein is a member of the synuclein family, which also includes beta- and gamma-synuclein. Alpha-synuclein is a neuronal protein that plays many roles in synaptic activity such as membrane trafficking of synaptic vesicles and neurotransmitter release. Multiplications in SNCA have been implicated in genetic forms of Parkinson disease and pathological post-translational modifications of alpha-synuclein are a hallmark of Parkinsons disease. These modifications include phosphorylation, nitration, acetylation, truncation, and aggregation. C-terminal truncations of alpha-synuclein lead to increased aggregation. Evidence for the 1-122 truncation in brains of patients with Parkinsons disease and Lewy Body Dementia (LBD).

Product Properties

• Clonality: Monoclonal
• Molecular Weight: 14kDa
• NCBI: 6622
• UniProt: P37840
• Purity: Affinity purification
• Sequence: MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDN
• Target: SNCA

Application Notes

• Application Dilute: Slot blot,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human. ResearchArea: Protein phosphorylation,Cell Biology Developmental Biology,Apoptosis,Neuroscience,Neurodegenerative Diseases,Amyloid Plaque and Neurofibrillary Tangle Formation in Alzheimers Disease,Dopamine Signaling in Parkinsons Disease,Neurodegenerative Diseases Markers. Shipping: Ice Bag

Images

Slot blot analysis of various lysates using Alpha-synuclein Truncation 1-122 mAb [MJFF-C-10B7] (A27452) at 1:2000 dilution incubated overnight at 4°C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 200 ng per lane.
Blocking buffer: Intercept Blocking Buffer.