VGLUT2 Rabbit mAb, Unconjugated

Product Overview

• Article Name: VGLUT2 Rabbit mAb, Unconjugated
• Biozol Catalog Number: ABB-A27586
• Supplier Catalog Number: A27586
• Alternative Catalog Number: ABB-A27586-20UL,ABB-A27586-100UL,ABB-A27586-500UL,ABB-A27586-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, IF, IHC-P, WB
• Species Reactivity: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: DNPI, VGLUT2

Product Description

Predicted to enable L-glutamate transmembrane transporter activity and neurotransmitter transmembrane transporter activity. Involved in neurotransmitter loading into synaptic vesicle. Predicted to be located in synaptic vesicle. Predicted to be active in excitatory synapse. Predicted to be integral component of synaptic vesicle membrane.

Product Properties

• Molecular Weight: 64kDa
• NCBI: 57084
• UniProt: Q9P2U8
• Purity: Affinity purification
• Sequence: AALVHYGGVIFYAIFASGEKQPWADPEETSEEKCGFIHEDELDEETGDITQNYINYGTTKSYGATTQANGGWPSGWEKKEEFVQGEVQDSHSYKDRVDYS
• Target: SLC17A6

Application Notes

• Application Dilute: WB,1:3000 - 1:12000|IF/ICC,1:200 - 1:400|IF-F,1:200 - 1:400|IF-P,1:200 - 1:400|IHC-P,1:1500 - 1:6000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Neuroscience.

Images

Immunohistochemistry analysis of paraffin-embedded Human brain tissue using VGLUT2 Rabbit mAb (A27586) at a dilution of 1:6000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Mouse brain tissue using VGLUT2 Rabbit mAb (A27586) at a dilution of 1:6000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Western blot analysis of various lysates using VGLUT2 Rabbit mAb (A27586) at 1:6000 dilutionincubated overnight at 4°C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Negative control (NC): Mouse spleen
Exposure time: 60s.

Immunohistochemistry analysis of paraffin-embedded Rat brain tissue using VGLUT2 Rabbit mAb (A27586) at a dilution of 1:6000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Confocal imaging of paraffin-embedded Human brain tissue using VGLUT2 Rabbit mAb (A27586, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x.

Confocal imaging of paraffin-embedded Rat brain tissue using VGLUT2 Rabbit mAb (A27586, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x.

Confocal imaging of 293T transfected with SLC17A6-His(C) and 293T cells using VGLUT2 Rabbit mAb (A27586, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 100x.

Confocal imaging of paraffin-embedded Mouse brain tissue using VGLUT2 Rabbit mAb (A27586, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x.

Confocal imaging of frozen sections Mouse brain tissue using VGLUT2 Rabbit mAb (A27586, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Microwave antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x.