[KO Validated] Rbm7 Rabbit mAb, Unconjugated

Catalog Number: ABB-A27655
Article Name: [KO Validated] Rbm7 Rabbit mAb, Unconjugated
Biozol Catalog Number: ABB-A27655
Supplier Catalog Number: A27655
Alternative Catalog Number: ABB-A27655-500UL,ABB-A27655-20UL,ABB-A27655-1000UL,ABB-A27655-100UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, IHC-P, IP, WB
Species Reactivity: Mouse
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: 1200007M24Rik, 1500011D06Rik
Predicted to enable 14-3-3 protein binding activity and RNA binding activity. Predicted to be involved in regulation of alternative mRNA splicing, via spliceosome and snRNA catabolic process. Located in nucleus. Orthologous to human RBM7 (RNA binding motif protein 7).
Molecular Weight: 30kDa
NCBI: 67010
UniProt: Q9CQT2
Purity: Affinity purification
Sequence: GSSHASQDASVSYPQHHVGNLSPTSTSPNSYERTVGNVSPTAQMVQRSFSSPEDYQRQAVMNSVFRQMSYAGKFGSPHADQLGFSPSAQPHGHTFNQSSSSQWRQDALSSQRKRQNSHPYLADRHYSREQRYSDHGSDYHYRGSREDFYYDDRNHDGWSHDYDNRRDSSRGGKWPSSRH
Target: Rbm7
Application Dilute: WB,1:2500 - 1:10000|IP,0.5µg-4µg antibody for 200µg-400µg extracts of whole cells|IF-P,1:200 - 1:1000|IHC-P,1:2000 - 1:8000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Mouse,Rat, ResearchArea: Epigenetics and Nuclear Signaling DNA / RNA RNA Processing SplicingEpigenetics and Nuclear Signaling Chromatin Binding Proteins DNA / RNA bindingDevelopmental Biology Reproduction Germ cell markers
Immunohistochemistry analysis of paraffin-embedded Rat colon tissue using [KO Validated] Rbm7 Rabbit mAb (A27655) at a dilution of 1:5000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Mouse lung tissue using [KO Validated] Rbm7 Rabbit mAb (A27655) at a dilution of 1:5000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Western blot analysis of lysates from wild type (WT) and Rbm7 knockout (KO) mouse testis using [KO Validated] Rbm7 Rabbit mAb (A27655) at 1:5000 dilution incubated at room temperature for 1.5 hours.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.
<,b>,WB samples for antibody validation are kindly provided by Dr. Shaorong Gao.<,/b>,
Immunohistochemistry analysis of paraffin-embedded Rat kidney tissue using [KO Validated] Rbm7 Rabbit mAb (A27655) at a dilution of 1:5000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Confocal imaging of paraffin-embedded Rat testis tissue using [KO Validated] Rbm7 Rabbit mAb (A27655, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x.
Confocal imaging of paraffin-embedded Rat colon tissue using [KO Validated] Rbm7 Rabbit mAb (A27655, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x.
Confocal imaging of paraffin-embedded Mouse testis tissue using [KO Validated] Rbm7 Rabbit mAb (A27655, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x.
Confocal imaging of paraffin-embedded Mouse colon tissue using [KO Validated] Rbm7 Rabbit mAb (A27655, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x.
Immunoprecipitation of Rbm7 from 300 µg extracts of Mouse testis tissue was performed using 0.5 µg of [KO Validated] Rbm7 Rabbit mAb (A27655). Rabbit IgG isotype control (AC005) was used to precipitate the Control IgG sample. IP samples were eluted with 1X reducing Laemmli Buffer. The Input lane represents 10% of the total input. Western blot analysis of immunoprecipitates was conducted using [KO Validated] Rbm7 Rabbit mAb (A27655) at a dilution of 1:4000.