IL1beta Rabbit mAb, Unconjugated

Product Overview

• Article Name: IL1beta Rabbit mAb, Unconjugated
• Biozol Catalog Number: ABB-A27676
• Supplier Catalog Number: A27676
• Alternative Catalog Number: ABB-A27676-100UL,ABB-A27676-500UL,ABB-A27676-1000UL,ABB-A27676-20UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, IF, IHC-P, WB
• Species Reactivity: Mouse
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: Il-1b, IL-1beta, IL1beta

Product Description

The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine is produced by activated macrophages as a proprotein, which is proteolytically processed to its active form by caspase 1. The encoded protein plays a role in thymocyte proliferation and is involved in the inflammatory response.

Product Properties

• Molecular Weight: 31kDa
• NCBI: 16176
• UniProt: P10749
• Purity: Affinity purification
• Sequence: VPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVALGLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNWYISTSQAEHKPVFLGNNSGQDIIDFTMESVSS
• Target: Il1b

Application Notes

• Application Dilute: WB,1:2000 - 1:4000|IF/ICC,1:100 - 1:200|IHC-P,1:200 - 1:800|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Immunology Innate Immunity Cytokines InterleukinsMicrobiology Organism Virus RNA Virus ssRNA positive strand virus SARS CoronavirusCardiovascular Atherosclerosis Vascular Inflammation Inflammatory mediatorsMetabolism Types of disease ObesityNeuroscience Processes

Images

Western blot analysis of various lysates using IL1beta Rabbit mAb (A27676) at 1:4000 dilutionincubated at room temperature for 1.5 hours. THP-1 and Raw264.7 cells were treated with LPS (1 µg/mL) at 37°C for 8 hours.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 30 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Immunohistochemistry analysis of paraffin-embedded SLE Mouse spleen and normal Mouse spleen tissue using IL1beta Rabbit mAb (A27676) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded SLE Mouse spleen tissue using IL1beta Rabbit mAb (A27676) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded SLE Mouse thymus tissue using IL1beta Rabbit mAb (A27676) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Raw264.7 and Raw264.7 treated with LPS using IL1beta Rabbit mAb (A27676) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded THP-1 and THP-1 treated with LPS using IL1beta Rabbit mAb (A27676) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Confocal imaging of RAW 264.7 cells (treated with BFA and LPS) and RAW 264.7 cells (untreated) using IL1beta Rabbit mAb (A27676, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 100x.

Confocal imaging of NR8383 cells (treated with BFA and LPS) and NR8383 cells (untreated) using IL1beta Rabbit mAb (A27676, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 100x.

Confocal imaging of THP-1 cells (treated with LPS) and THP-1 cells (untreated) using IL1beta Rabbit mAb (A27676, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 100x.