PI3K-gamma Rabbit mAb, Unconjugated, Monoclonal

Product Overview

• Article Name: PI3K-gamma Rabbit mAb, Unconjugated, Monoclonal
• Biozol Catalog Number: ABB-A27717
• Supplier Catalog Number: A27717
• Alternative Catalog Number: ABB-A27717-1000UL,ABB-A27717-20UL,ABB-A27717-100UL,ABB-A27717-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: PI3K, PIK3, IMD97, PI3CG, PI3Kgamma, p110gamma, p120-PI3K

Product Description

Phosphoinositide 3-kinases (PI3Ks) phosphorylate inositol lipids and are involved in the immune response. The protein encoded by this gene is a class I catalytic subunit of PI3K. Like other class I catalytic subunits (p110-alpha p110-beta, and p110-delta), the encoded protein binds a p85 regulatory subunit to form PI3K. This gene is located in a commonly deleted segment of chromosome 7 previously identified in myeloid leukemias. Several transcript variants encoding the same protein have been found for this gene.

Product Properties

• Clonality: Monoclonal
• Molecular Weight: 126kDa
• NCBI: 5294
• UniProt: P48736
• Purity: Affinity purification
• Sequence: RSPGQIHLVQRHPPSEESQAFQRQLTALIGYDVTDVSNVHDDELEFTRRGLVTPRMAEVASRDPKLYAMHPWVTSKPLPEYLWKKIANNCIFIVIHRSTTSQTIKVSPDDTPGAILQSFFTKMAKKKSLMDIPESQSEQDFVLRVCGRDEYLVGETPIKNFQWVRHCLKNGEEIHVVLDTPPDPALDEVRKEEWPLVDDCTGVTGYHEQLTIH
• Target: PIK3CG

Application Notes

• Application Dilute: WB,1:2500 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse. ResearchArea: Epigenetics Nuclear Signaling,Translation Control,Regulation of eIF4 and p70 S6 Kinase,Cancer,Signal Transduction,G protein signaling,G-Protein-Coupled ReceptorsGPCR,G-Protein-Coupled Receptors Signaling to MAPK Erk,Kinase,PI3K-Akt Signaling Pathway,mTOR Signaling Pathway,ErbB-HER Signaling Pathway,MAPK-Erk Signaling Pathway,MAPK-JNK Signaling Pathway,Cell Biology Developmental Biology,Apoptosis,Mitochondrial Control of Apoptosis,Inhibition of Apoptosis,Autophagy,Cell Adhesion,Cytoskeleton,Microtubules,Actins,TGF-b-Smad Signaling Pathway,ESC Pluripotency and Differentiation,Endocrine Metabolism,Lipid Metabolism,AMPK Signaling Pathway,Warburg Effect,Immunology Inflammation,B Cell Receptor Signaling Pathway,T Cell Receptor Signaling Pathway,Jak-Stat-IL-6 Receptor Signaling Pathway,NF-kB Signaling Pathway,Toll-like Receptor Signaling Pathway,Cell Intrinsic Innate Immunity Signaling Pathway,TLR Signaling,Cardiovascular,Angiogenesis. Shipping: Ice Bag

Images

Western blot analysis of various lysates using PI3K-gamma Rabbit mAb (A27717) at 1:5000 dilutionincubated at room temperature for 1.5 hours.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Negative control (NC): A549
Exposure time: 90s.