DNAJC7 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: DNAJC7 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A2780
• Supplier Catalog Number: A2780
• Alternative Catalog Number: ABB-A2780-20UL,ABB-A2780-100UL,ABB-A2780-500UL,ABB-A2780-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: DJ11, DJC7, TPR2, TTC2, DNAJC7

Product Description

This gene encodes a member of the DNAJ heat shock protein 40 family of proteins that is characterized by two N-terminal tetratricopeptide repeat domains and a C-terminal DNAJ domain. This protein binds the chaperone proteins heat shock proteins 70 and 90 in an ATP-dependent manner and may function as a co-chaperone. Pseudogenes of this gene are found on chromosomes 1 and 6. Alternate splicing results in multiple transcript variants.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 56kDa
• NCBI: 7266
• UniProt: Q99615
• Purity: Affinity purification
• Sequence: VQFFVQALRMAPDHEKACIACRNAKALKAKKEDGNKAFKEGNYKLAYELYTEALGIDPNNIKTNAKLYCNRGTVNSKLRKLDDAIEDCTNAVKLDDTYIKAYLRRAQCYMDTEQYEEAVRDYEKVYQTEKTKEHKQLLKNAQLELKKSKRK
• Target: DNAJC7
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:1000 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human. ResearchArea: Cell Biology Developmental Biology. Shipping: Ice Bag

Images

Western blot analysis of various lysates using DNAJC7 Rabbit pAb (A2780) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.