PKD2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A27895
Article Name: PKD2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A27895
Supplier Catalog Number: A27895
Alternative Catalog Number: ABB-A27895-100UL,ABB-A27895-1000UL,ABB-A27895-500UL,ABB-A27895-20UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: PC2, PKD4, Pc-2, APKD2, TRPP2
This gene encodes a member of the polycystin protein family. The encoded protein is a multi-pass membrane protein that functions as a calcium permeable cation channel, and is involved in calcium transport and calcium signaling in renal epithelial cells. This protein interacts with polycystin 1, and they may be partners in a common signaling cascade involved in tubular morphogenesis. Mutations in this gene are associated with autosomal dominant polycystic kidney disease type 2.
Clonality: Polyclonal
Molecular Weight: 110kDa
NCBI: 5311
UniProt: Q13563
Purity: Affinity purification
Sequence: QGGGKLNFDELRQDLKGKGHTDAEIEAIFTKYDQDGDQELTEHEHQQMRDDLEKEREDLDLDHSSLPRPMSSRSFPRSLDDSEEDDDEDSGHSSRRRGSI
Target: PKD2
Application Dilute: WB,1:1500 - 1:6000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Signal Transduction,Cell Biology Developmental Biology,Cell Cycle,Centrosome,Growth factors,Endocrine Metabolism,Neuroscience,Calcium Signaling. Shipping: Ice Bag
Western blot analysis of lysates from Rat testis using PKD2 Rabbit pAb (A27895) at 1:3000 dilution incubated at room temperature for 1.5 hours.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 45s.