NUP214 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A27954
Article Name: NUP214 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A27954
Supplier Catalog Number: A27954
Alternative Catalog Number: ABB-A27954-100UL,ABB-A27954-20UL,ABB-A27954-500UL,ABB-A27954-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IP, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: CAN, CAIN, IIAE9
The nuclear pore complex is a massive structure that extends across the nuclear envelope, forming a gateway that regulates the flow of macromolecules between the nucleus and the cytoplasm. Nucleoporins are the main components of the nuclear pore complex in eukaryotic cells. This gene is a member of the FG-repeat-containing nucleoporins. The protein encoded by this gene is localized to the cytoplasmic face of the nuclear pore complex where it is required for proper cell cycle progression and nucleocytoplasmic transport. The 3 portion of this gene forms a fusion gene with the DEK gene on chromosome 6 in a t(6,9) translocation associated with acute myeloid leukemia and myelodysplastic syndrome. Alternative splicing of this gene results in multiple transcript variants encoding different isoforms.
Clonality: Polyclonal
Molecular Weight: 214kDa
NCBI: 8021
UniProt: P35658
Purity: Affinity purification
Sequence: QPDAFSSGGGSKPSYEAIPESSPPSGITSASNTTPGEPAASSSRPVAPSGTALSTTSSKLETPPSKLGELLFPSSLAGETLGSFSGLRVGQADDSTKPTN
Target: NUP214
Application Dilute: WB,1:1000 - 1:3000|IP,0.5µg-4µg antibody for 200µg-400µg extracts of whole cells|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling,Nuclear Receptor Signaling. Shipping: Ice Bag
Western blot analysis of lysates from HeLa cells using NUP214 Rabbit pAb (A27954) at 1:3000 dilution incubated at room temperature for 1.5 hours.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.