NUP214 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: NUP214 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A27954
• Supplier Catalog Number: A27954
• Alternative Catalog Number: ABB-A27954-100UL,ABB-A27954-20UL,ABB-A27954-500UL,ABB-A27954-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, IP, WB
• Species Reactivity: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: CAN, CAIN, IIAE9

Product Description

The nuclear pore complex is a massive structure that extends across the nuclear envelope, forming a gateway that regulates the flow of macromolecules between the nucleus and the cytoplasm. Nucleoporins are the main components of the nuclear pore complex in eukaryotic cells. This gene is a member of the FG-repeat-containing nucleoporins. The protein encoded by this gene is localized to the cytoplasmic face of the nuclear pore complex where it is required for proper cell cycle progression and nucleocytoplasmic transport. The 3 portion of this gene forms a fusion gene with the DEK gene on chromosome 6 in a t(6,9) translocation associated with acute myeloid leukemia and myelodysplastic syndrome. Alternative splicing of this gene results in multiple transcript variants encoding different isoforms.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 214kDa
• NCBI: 8021
• UniProt: P35658
• Purity: Affinity purification
• Sequence: QPDAFSSGGGSKPSYEAIPESSPPSGITSASNTTPGEPAASSSRPVAPSGTALSTTSSKLETPPSKLGELLFPSSLAGETLGSFSGLRVGQADDSTKPTN
• Target: NUP214

Application Notes

• Application Dilute: WB,1:1000 - 1:3000|IP,0.5µg-4µg antibody for 200µg-400µg extracts of whole cells|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling,Nuclear Receptor Signaling. Shipping: Ice Bag

Images

Western blot analysis of lysates from HeLa cells using NUP214 Rabbit pAb (A27954) at 1:3000 dilution incubated at room temperature for 1.5 hours.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.