Chemerin Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: Chemerin Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A28009
• Supplier Catalog Number: A28009
• Alternative Catalog Number: ABB-A28009-500UL,ABB-A28009-1000UL,ABB-A28009-100UL,ABB-A28009-20UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Mouse
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: 0610007L05Rik

Product Description

Predicted to enable signaling receptor binding activity. Involved in several processes, including positive regulation of fat cell differentiation, regulation of insulin receptor signaling pathway, and regulation of primary metabolic process. Acts upstream of or within brown fat cell differentiation. Located in extracellular region. Is expressed in genitourinary system, jaw, and retina. Orthologous to human RARRES2 (retinoic acid receptor responder 2).

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 18kDa
• NCBI: 71660
• UniProt: Q9DD06
• Purity: Affinity purification
• Sequence: EPELSETQRRSLQVALEEFHKHPPVQLAFQEIGVDRAEEVLFSAGTFVRLEFKLQQTNCPKKDWKKPECTIKPNGRRRKCLACIKMDPKGKILGRIVHCPILKQGPQDPQELQCIKIAQAGEDPHGYFLPGQFAFSRALRTK
• Target: Rarres2

Application Notes

• Application Dilute: WB,1:2500 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Mouse,Rat. ResearchArea: Cardiovascular Blood OtherCardiovascular Lipids / Lipoproteins Lipid Metabolism HydrolysisCardiovascular Lipids / Lipoproteins Adipose Related AcrpSignal Transduction Metabolism Lipid metabolismMetabolism Pathways and Processes Metabolic signaling pathways Lipid and lipoprotein metabolism HydrolysisMetabolism Types of disease Cancer. Shipping: Ice Bag

Images

Western blot analysis of lysates from Rat liver using Chemerin Rabbit pAb (A28009) at 1:5000 dilution incubated overnight at 4°C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.