Clathrin heavy chain Rabbit mAb, Unconjugated

Product Overview

• Article Name: Clathrin heavy chain Rabbit mAb, Unconjugated
• Biozol Catalog Number: ABB-A28030
• Supplier Catalog Number: A28030
• Alternative Catalog Number: ABB-A28030-100UL,ABB-A28030-20UL,ABB-A28030-500UL,ABB-A28030-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, IF, IHC-P, IP, WB
• Species Reactivity: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: Hc, CHC, CHC17, MRD56, CLH-17, CLTCL2

Product Description

Clathrin is a major protein component of the cytoplasmic face of intracellular organelles, called coated vesicles and coated pits. These specialized organelles are involved in the intracellular trafficking of receptors and endocytosis of a variety of macromolecules. The basic subunit of the clathrin coat is composed of three heavy chains and three light chains.

Product Properties

• Molecular Weight: 187kDa
• NCBI: 1213
• UniProt: Q00610
• Purity: Affinity purification
• Sequence: FTCYDLLRPDVVLETAWRHNIMDFAMPYFIQVMKEYLTKVDKLDASESLRKEEEQATETQPIVYGQPQLMLTAGPSVAVPPQAPFGYGYTAPPYGQPQPG
• Target: CLTC

Application Notes

• Application Dilute: WB,1:5000 - 1:30000|IP,0.5µg-4µg antibody for 200µg-400µg extracts of whole cells|IF/ICC,1:200 - 1:1000|IHC-P,1:1500 - 1:6000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cell Adhesion,Immunology Inflammation,B Cell Receptor Signaling Pathway,Neuroscience,Neurodegenerative Diseases.

Images

Western blot analysis of various lysates using Clathrin heavy chain Rabbit mAb (A28030) at 1:5000 dilution incubated overnight at 4°C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

Immunohistochemistry analysis of paraffin-embedded Mouse testis tissue using Clathrin heavy chain Rabbit mAb (A28030) at a dilution of 1:5000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human placenta tissue using Clathrin heavy chain Rabbit mAb (A28030) at a dilution of 1:5000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Rat testis tissue using Clathrin heavy chain Rabbit mAb (A28030) at a dilution of 1:5000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Confocal imaging of HeLa cells using Clathrin heavy chain Rabbit mAb (A28030, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). The cells were counterstained with alpha-Tubulin Mouse mAb (AC012, dilution 1:400) followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (AS076, dilution 1:500) (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.

Confocal imaging of C6 cells using Clathrin heavy chain Rabbit mAb (A28030, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). The cells were counterstained with alpha-Tubulin Mouse mAb (AC012, dilution 1:400) followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (AS076, dilution 1:500) (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.

Confocal imaging of NIH/3T3 cells using Clathrin heavy chain Rabbit mAb (A28030, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). The cells were counterstained with alpha-Tubulin Mouse mAb (AC012, dilution 1:400) followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (AS076, dilution 1:500) (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.

Confocal imaging of SH-SY5Y cells using Clathrin heavy chain Rabbit mAb (A28030, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 100x.

Immunoprecipitation of Clathrin heavy chain from 300 µg extracts of 293F cells was performed using 1 µg of Clathrin heavy chain Rabbit mAb (A28030). Rabbit Control IgG (AC005) was used to precipitate the Control IgG sample. IP samples were eluted with 1X Laemmli Buffer. The Input lane represents 10% of the total input. Western blot analysis of immunoprecipitates was conducted using Clathrin heavy chain Rabbit mAb (A28030) at a dilution of 1:5000.