HDAC3 Rabbit mAb, Unconjugated

Product Overview

• Article Name: HDAC3 Rabbit mAb, Unconjugated
• Biozol Catalog Number: ABB-A28114
• Supplier Catalog Number: A28114
• Alternative Catalog Number: ABB-A28114-20UL,ABB-A28114-100UL,ABB-A28114-1000UL,ABB-A28114-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, IF, IHC-P, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: HD3, RPD3, KDAC3, RPD3-2

Product Description

Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. The protein encoded by this gene belongs to the histone deacetylase/acuc/apha family. It has histone deacetylase activity and represses transcription when tethered to a promoter. It may participate in the regulation of transcription through its binding with the zinc-finger transcription factor YY1. This protein can also down-regulate p53 function and thus modulate cell growth and apoptosis. This gene is regarded as a potential tumor suppressor gene.

Product Properties

• Molecular Weight: 49 kDa
• NCBI: 8841
• UniProt: O15379
• Purity: Affinity purification
• Sequence: TVRNVARCWTYETSLLVEEAISEELPYSEYFEYFAPDFTLHPDVSTRIENQNSRQYLDQIRQTIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADAEERGPEENYSRPEAPNEFYDGDHDNDKESDVEI
• Target: HDAC3

Application Notes

• Application Dilute: WB,1:3000 - 1:10000|IF/ICC,1:100 - 1:200|IHC-P,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. For high-ratio antibody dilutions (1:10000),a sequential diluti
• Application Notes: Cross-Reactivity: Human,Mouse,Rat,Monkey, ResearchArea: Epigenetics Nuclear Signaling,Nuclear Receptor Signaling,Cancer,Tumor suppressors,Signal Transduction,Cell Biology Developmental Biology,Apoptosis,Cell Cycle,Cell Cycle Control-G1 S Checkpoint,Wnt ??-Catenin Signaling Pathway,Endocrine Metabolism,Lipid Metabolism,Immunology Inflammation,NF-kB Signaling Pathway,Stem Cells,Cardiovascular,Heart,Hypertrophy,Lipids.

Images

Western blot analysis of various lysates using HDAC3 Rabbit mAb (A28114) at 1:5000 dilution incubated overnight at 4°C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 20 s.

Immunohistochemistry analysis of paraffin-embedded Human colon tissue using HDAC3 Rabbit mAb (A28114) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human cervix tissue using HDAC3 Rabbit mAb (A28114) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human thyroid cancer tissue using HDAC3 Rabbit mAb (A28114) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Mouse lung tissue using HDAC3 Rabbit mAb (A28114) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Rat thymus tissue using HDAC3 Rabbit mAb (A28114) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Confocal imaging of HeLa cells using HDAC3 Rabbit mAb (A28114, dilution 1:200) followed by a further incubation with Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). The cells were counterstained with alpha-Tubulin Mouse mAb (AC012, dilution 1:400) followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) (AS076, dilution 1:500) (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.

Confocal imaging of NIH/3T3 cells using HDAC3 Rabbit mAb (A28114, dilution 1:200) followed by a further incubation with Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). The cells were counterstained with alpha-Tubulin Mouse mAb (AC012, dilution 1:400) followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) (AS076, dilution 1:500) (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.

Confocal imaging of C6 cells using HDAC3 Rabbit mAb (A28114, dilution 1:200) followed by a further incubation with Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). The cells were counterstained with alpha-Tubulin Mouse mAb (AC012, dilution 1:400) followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) (AS076, dilution 1:500) (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.