PE Rabbit anti-Chicken CD25 mAb, Monoclonal

Catalog Number: ABB-A28169
Article Name: PE Rabbit anti-Chicken CD25 mAb, Monoclonal
Biozol Catalog Number: ABB-A28169
Supplier Catalog Number: A28169
Alternative Catalog Number: ABB-A28169-100UG,ABB-A28169-50UG
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: FC
Species Reactivity: Mouse
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: PE
Alternative Names: CD25, Il2r, Ly-43, p55, CD25, IL2R, IMD41, TCGFR, IDDM10
CD25 is the alpha chain of the heterotrimeric IL-2 receptor and is highly expressed in many types of hematologic malignancies but shows low expression in most solid tumors. CD25 is also abundantly expressed on activated circulating immune cells and regulatory T cells (Tregs). The infiltration of Tregs into the tumor microenvironment can lead to an imbalance in the ratio of effector T cells (Teffs) to Tregs, which is associated with tumor progression. Restoring a balanced Teff/Treg ratio may enhance the efficacy of immunotherapy. As a potential target for Treg depletion, CD25 plays a critical role in the development of novel immunotherapeutic strategies.
Clonality: Monoclonal
Concentration: FC
Molecular Weight: 24 kDa
NCBI: 395294
UniProt: Q90WJ4
Purity: Affinity purification
Sequence: DKCPRLSTTEFADVAAETYPLKTKLRYECDSGYRRRSGNTLTIRCQNVSGTASWVHDELVCIDEKFLFSRNHTAKLNPTQQPARQTQSPAPPKQANNSSFCGMPQTVPHASLSVHQIYSVGQVLHFKCPTGYNKQLPTTGTITCKNVDGRIKWTPADRPCTNDSGPINKQ
Target: IL2RA
Application Dilute: FC,0.5 µg per million cells in 100 µl volume
Application Notes: Cross-Reactivity: Chicken. ResearchArea: Cell Biology Developmental Biology,Immunology Inflammation,CDs,Cytokines,Interleukins. Shipping: Ice Bag
Flow cytometry:1X10 6 Chicken PBMC were surface-stained with APC Rabbit anti-Chicken CD4 mAb (5 µl/Test) and PE Rabbit IgG isotype control (A24172,5 µl/Test,left) or PE Rabbit anti-Chicken CD25 mAb (A28169,0.5 µg,right).