PE Rabbit anti-Human IgG (Fc) mAb, Monoclonal

Product Overview

• Article Name: PE Rabbit anti-Human IgG (Fc) mAb, Monoclonal
• Biozol Catalog Number: ABB-A28177
• Supplier Catalog Number: A28177
• Alternative Catalog Number: ABB-A28177-50UG,ABB-A28177-100UG
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: FC
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: PE
• Alternative Names: IGHG1

Product Description

Predicted to enable antigen binding activity and immunoglobulin receptor binding activity. Predicted to be involved in several processes, including activation of immune response, defense response to other organism, and phagocytosis. Predicted to act upstream of or within several processes, including immunoglobulin mediated immune response, positive regulation of hypersensitivity, and positive regulation of phagocytosis. Located in extracellular space.

Product Properties

• Clonality: Monoclonal
• Concentration: FC
• Molecular Weight: 36 kDa
• NCBI: 3500
• UniProt: P01857
• Purity: Affinity purification
• Sequence: PKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
• Target: IGHG1

Application Notes

• Application Dilute: FC,0.25 µg per million cells in 100 µl volume
• Application Notes: Cross-Reactivity: Human. ResearchArea: Immunology Inflammation. Shipping: Ice Bag

Images

Flow cytometry:1X10 6 Human PBMC were surface-stained with ABflo 450 Rabbit anti-Human/Monkey CD19 mAb (A27286,5 µl/Test) and PE Rabbit IgG isotype control (A24172,5 µl/Test,left) or PE Rabbit anti-Human IgG(Fc) mAb (A28177,0.25 µg,right). Cells in the lymphocyte gate were used for analysis.