ABflo 647 Rabbit anti-Mouse IFN-gamma mAb, Monoclonal

Product Overview

• Article Name: ABflo 647 Rabbit anti-Mouse IFN-gamma mAb, Monoclonal
• Biozol Catalog Number: ABB-A28242
• Supplier Catalog Number: A28242
• Alternative Catalog Number: ABB-A28242-50UG,ABB-A28242-100UG
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: FC
• Species Reactivity: Mouse
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: ABflo 647
• Alternative Names: Ifg, If2f, IFN-g

Product Description

This gene encodes a soluble cytokine that is a member of the type II interferon class. The encoded protein is secreted by cells of both the innate and adaptive immune systems. The active protein is a homodimer that binds to the interferon gamma receptor which triggers a cellular response to viral and microbial infections. Mice deficient in this gene have increased susceptibility to viral, bacterial and parasitic infections and to several autoimmune diseases.

Product Properties

• Clonality: Monoclonal
• Concentration: FC (intra)
• Molecular Weight: 18 kDa
• NCBI: 15978
• UniProt: P01580
• Purity: Affinity purification
• Sequence: MNATHCILALQLFLMAVSGCYCHGTVIESLESLNNYFNSSGIDVEEKSLFLDIWRNWQKDGDMKILQSQIISFYLRLFEVLKDNQAISNNISVIESHLITTFFSNSKAKKDAFMSIAKFEVNNPQVQRQAFNELIRVVHQLLPESSLRKRKRSRC
• Target: IFNG

Application Notes

• Application Dilute: FC (intra),0.5 µg per million cells in 100 µl volume
• Application Notes: Cross-Reactivity: Mouse. ResearchArea: Immunology Innate Immunity Macrophage / Inflamm.Immunology Innate Immunity Cytokines InterferonsMicrobiology Interspecies Interaction Host Virus InteractionStem Cells Signaling Pathways TGF beta Interferon gammaStem Cells Hematopoietic Progenitors Surface MoleculesImmunology Immune System Diseases Antiviral SignalingCancer Tumor immunology Cytokines InterferonsStem Cells Hematopoietic Progenitors Lymphoid B Lymphocytic LineageStem Cells Hematopoietic Progenitors Lymphoid T Lymphocytic LineageStem Cells Hematopoietic Progenitors Lymphoid NK Cell LineageStem Cells Hematopoietic Progenitors Myeloid Dendritic Cell LineageStem Cells Hematopoietic Progenitors Myeloid Monocytic LineageStem Cells Hematopoietic Progenitors Myeloid Neutrophil LineageImmunology Adaptive Immunity Regulatory T CellsMicrobiology Interspecies Interaction DiseaseNeuroscience Processes. Shipping: Ice Bag

Images

Flow cytometry: 1X10 6 C57BL/6 mouse splenocytes (untreated,left) and Th1-polarized C57BL/6 mouse splenocytes (treated with 50ng/ml PMA + 1ug/ml Ionomycin + 1ug/ml Brefeldin A or Monensin for 6 hours,right) were surface-stained with PE Rabbit anti-Mouse CD4 mAb (A25933,5 µl/Test) , then intracellularly-stained ABflo 647 Rabbit anti-Mouse IFN-gamma mAb (A28242,0.5 µg).