DLAT Rabbit mAb, Unconjugated

Product Overview

• Article Name: DLAT Rabbit mAb, Unconjugated
• Biozol Catalog Number: ABB-A28247
• Supplier Catalog Number: A28247
• Alternative Catalog Number: ABB-A28247-20UL,ABB-A28247-500UL,ABB-A28247-100UL,ABB-A28247-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, IF, IHC-P, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: E2, PBC, DLTA, PDCE2, PDC-E2

Product Description

This gene encodes component E2 of the multi-enzyme pyruvate dehydrogenase complex (PDC). PDC resides in the inner mitochondrial membrane and catalyzes the conversion of pyruvate to acetyl coenzyme A. The protein product of this gene, dihydrolipoamide acetyltransferase, accepts acetyl groups formed by the oxidative decarboxylation of pyruvate and transfers them to coenzyme A. Dihydrolipoamide acetyltransferase is the antigen for antimitochondrial antibodies. These autoantibodies are present in nearly 95% of patients with the autoimmune liver disease primary biliary cirrhosis (PBC). In PBC, activated T lymphocytes attack and destroy epithelial cells in the bile duct where this protein is abnormally distributed and overexpressed. PBC enventually leads to cirrhosis and liver failure. Mutations in this gene are also a cause of pyruvate dehydrogenase E2 deficiency which causes primary lactic acidosis in infancy and early childhood.

Product Properties

• Molecular Weight: 69 kDa
• NCBI: 1737
• UniProt: P10515
• Purity: Affinity purification
• Sequence: SLPPHQKVPLPSLSPTMQAGTIARWEKKEGDKINEGDLIAEVETDKATVGFESLEECYMAKILVAEGTRDVPIGAIICITVGKPEDIEAFKNYTLDSSAAPTPQAAPAPTPAATASPPTPSAQAPGSSYPPHMQVLLPALSPTMTMGTVQRWEKKVGEKLSEGDLLAEIETDKATIGFEVQEEG
• Target: DLAT

Application Notes

• Application Dilute: WB,1:60000 - 1:200000|IF/ICC,1:200 - 1:1200|IHC-P,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. For high-ratio antibody dilutions (1:10000),a sequential dil
• Application Notes: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Cancer,Signal Transduction,Endocrine Metabolism,Mitochondrial metabolism,Mitochondrial markers,Carbohydrate metabolism.

Images

Western blot analysis of lysates from HeLa cells using DLAT Rabbit mAb (A28247) at 1:100000 dilution incubated overnight at 4°C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 45 s.

Western blot analysis of various lysates using DLAT Rabbit mAb (A28247) at 1:100000 dilution incubated overnight at 4°C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 45 s.

Immunohistochemistry analysis of paraffin-embedded Mouse testis tissue using DLAT Rabbit mAb (A28247) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human placenta tissue using DLAT Rabbit mAb (A28247) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Rat kidney tissue using DLAT Rabbit mAb (A28247) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Confocal imaging of HeLa cells using DLAT Rabbit mAb (A28247, dilution 1:1200) followed by a further incubation with Cy3-conjugated Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). The cells were counterstained with alpha-Tubulin Mouse mAb (AC012, dilution 1:400) followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) (AS076, dilution 1:500) (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.

Confocal imaging of Hep G2 cells using DLAT Rabbit mAb (A28247, dilution 1:1200) followed by a further incubation with Cy3-conjugated Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). The cells were counterstained with alpha-Tubulin Mouse mAb (AC012, dilution 1:400) followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) (AS076, dilution 1:500) (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.

Confocal imaging of NIH/3T3 cells using DLAT Rabbit mAb (A28247, dilution 1:1200) followed by a further incubation with Cy3-conjugated Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). The cells were counterstained with alpha-Tubulin Mouse mAb (AC012, dilution 1:400) followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) (AS076, dilution 1:500) (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.

Confocal imaging of C6 cells using DLAT Rabbit mAb (A28247, dilution 1:1200) followed by a further incubation with Cy3-conjugated Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). The cells were counterstained with alpha-Tubulin Mouse mAb (AC012, dilution 1:400) followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) (AS076, dilution 1:500) (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.