ADAMTS5 Rabbit pAb, Unconjugated

Product Overview

• Article Name: ADAMTS5 Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A2836
• Supplier Catalog Number: A2836
• Alternative Catalog Number: ABB-A2836-500UL,ABB-A2836-20UL,ABB-A2836-1000UL,ABB-A2836-100UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: ADAMTS5, ADAM-TS 11, ADAM-TS 5, ADAM-TS5, ADAMTS-11, ADAMTS-5, ADAMTS11, ADMP-2, ADAM-TS11

Product Description

This gene encodes a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs) protein family. Members of the family share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains. The encoded preproprotein is proteolytically processed to generate the mature enzyme. This enzyme contains two C-terminal TS motifs and functions as an aggrecanase that cleaves aggrecan, a major proteoglycan of cartilage, and may mediate cartilage destruction in osteoarthritis.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 101kDa
• NCBI: 11096
• UniProt: Q9UNA0
• Purity: Affinity purification
• Sequence: NNGRYCTGKRAIYRSCSLMPCPPNGKSFRHEQCEAKNGYQSDAKGVKTFVEWVPKYAGVLPADVCKLTCRAKGTGYYVVFSPKVTDGTECRLYSNSVCVR
• Target: ADAMTS5
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:1000 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Signal Transduction,Cell Biology & Developmental Biology,Cytoskeleton,Extracellular Matrix,ADAM Protein Family,MMPs,Ubiquitin.

Images

Western blot analysis of various lysates usingADAMTS5 Rabbit pAb (A2836) at1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Negative control (NC):THP-1.
Exposure time:20s.