CCL3L1 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: CCL3L1 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A2852
• Supplier Catalog Number: A2852
• Alternative Catalog Number: ABB-A2852-100UL,ABB-A2852-500UL,ABB-A2852-1000UL,ABB-A2852-20UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: LD78, 464.2, MIP1AP, SCYA3L, G0S19-2, SCYA3L1, D17S1718, LD78BETA, LD78-beta(1-70), CCL3L1

Product Description

This gene is one of several cytokine genes that are clustered on the q-arm of chromosome 17. Cytokines are a family of secreted proteins that function in inflammatory and immunoregulatory processes. The protein encoded by this gene binds to several chemokine receptors, including chemokine binding protein 2 and chemokine (C-C motif) receptor 5 (CCR5). CCR5 is a co-receptor for HIV, and binding of this protein to CCR5 inhibits HIV entry. The copy number of this gene varies among individuals, where most individuals have one to six copies, and a minority of individuals have zero or more than six copies. There are conflicting reports about copy number variation of this gene and its correlation to disease susceptibility. This record represents one of two copies that are present on the ALT_REF_LOCI_2 alternate haplotype of the GRCh38 human reference genome assembly. Alternative splicing of this gene results in multiple transcript variants.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 10kDa
• NCBI: 6349
• UniProt: P16619
• Purity: Affinity purification
• Sequence: APLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPSVIFLTKRGRQVCADPSEEWVQKYVSDLELSA
• Target: CCL3L1
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human. ResearchArea: Immunology Inflammation,Cytokines. Shipping: Ice Bag

Images

Western blot analysis of lysates from B-cell cells, using CCL3L1 Rabbit pAb (A2852) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 60s.