SLC1A6 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: SLC1A6 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A2904
• Supplier Catalog Number: A2904
• Alternative Catalog Number: ABB-A2904-1000UL,ABB-A2904-500UL,ABB-A2904-100UL,ABB-A2904-20UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: EAAT4, SLC1A6

Product Description

Predicted to enable high-affinity glutamate transmembrane transporter activity. Involved in neurotransmitter uptake. Located in intermediate filament cytoskeleton and plasma membrane.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 62kDa
• NCBI: 6511
• UniProt: P48664
• Purity: Affinity purification
• Sequence: PGKGSKEGLHREGRIETIPTADAFMDLIRNMFPPNLVEACFKQFKTQYSTRVVTRTMVRTENGSEPGASMPPPFSVENGTSFLENVTRALGTLQEMLSFEETVPVPGSANG
• Target: SLC1A6
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse. ResearchArea: Neuroscience. Shipping: Ice Bag

Images

Western blot analysis of various lysates using SLC1A6 Rabbit pAb (A2904) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.