FST Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: FST Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A2936
• Supplier Catalog Number: A2936
• Alternative Catalog Number: ABB-A2936-1000UL,ABB-A2936-500UL,ABB-A2936-100UL,ABB-A2936-20UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: FS, FST

Product Description

Follistatin is a single-chain gonadal protein that specifically inhibits follicle-stimulating hormone release. The single FST gene encodes two isoforms, FST317 and FST344 containing 317 and 344 amino acids respectively, resulting from alternative splicing of the precursor mRNA. In a study in which 37 candidate genes were tested for linkage and association with polycystic ovary syndrome (PCOS) or hyperandrogenemia in 150 families, evidence was found for linkage between PCOS and follistatin.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 38kDa
• NCBI: 10468
• UniProt: P19883
• Purity: Affinity purification
• Sequence: AACSSGVLLEVKHSGSCNSISEDTEEEEEDEDQDYSFPISSILEW
• Target: FST
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:100 - 1:500|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Rat. ResearchArea: Epigenetics Nuclear Signaling,Signal Transduction,Cell Biology Developmental Biology,Growth factors. Shipping: Ice Bag

Images

Western blot analysis of various lysates using FST Rabbit pAb (A2936) at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.