IGFBP1 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: IGFBP1 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A2981
• Supplier Catalog Number: A2981
• Alternative Catalog Number: ABB-A2981-20UL,ABB-A2981-100UL,ABB-A2981-1000UL,ABB-A2981-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: AFBP, IBP1, PP12, IGF-BP25, hIGFBP-1, IGFBP1

Product Description

This gene is a member of the insulin-like growth factor binding protein (IGFBP) family and encodes a protein with an IGFBP N-terminal domain and a thyroglobulin type-I domain. The encoded protein, mainly expressed in the liver, circulates in the plasma and binds both insulin-like growth factors (IGFs) I and II, prolonging their half-lives and altering their interaction with cell surface receptors. This protein is important in cell migration and metabolism. Low levels of this protein may be associated with impaired glucose tolerance, vascular disease and hypertension in human patients.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 28kDa
• NCBI: 3484
• UniProt: P08833
• Purity: Affinity purification
• Sequence: GLSCRALPGEQQPLHALTRGQGACVQESDASAPHAAEAGSPESPESTEITEEELLDNFHLMAPSEEDHSILWDAISTYDGSKALHVTNIKKWKEPCRIELYRVVESLAKAQETSGEEISKFYLPNCNKNGFYHSRQCETSMDGEAGLCWCVYPWNGKRIPGSPEIRGDPNCQIYFNVQN
• Target: IGFBP1
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Growth factors,Endocrine Metabolism,Endocrine and metabolic diseases,Diabetes,Cardiovascular. Shipping: Ice Bag

Images

Western blot analysis of lysates from HepG2 cells, using IGFBP1 Rabbit pAb (A2981) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.