SLC16A4 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: SLC16A4 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A3016
• Supplier Catalog Number: A3016
• Alternative Catalog Number: ABB-A3016-100UL,ABB-A3016-1000UL,ABB-A3016-500UL,ABB-A3016-20UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: MCT4, MCT5, SLC16A4

Product Description

Predicted to enable monocarboxylic acid transmembrane transporter activity. Predicted to be involved in monocarboxylic acid transport. Predicted to be located in membrane. Predicted to be integral component of plasma membrane.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 54kDa
• NCBI: 9122
• UniProt: O15374
• Purity: Affinity purification
• Sequence: TFPLLMTYTICFAIFAGGYLALILPVLVDLCRNSTVNRFLGLASFFAGMAVLSGPPIAGWLYDYTQTYNGSFYFSGICYLLSSVSFFFVPLAERWKNSLT
• Target: SLC16A4
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse. Shipping: Ice Bag

Images

Western blot analysis of various lysates using SLC16A4 Rabbit pAb (A3016) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.