BEST1 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: BEST1 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A3022
• Supplier Catalog Number: A3022
• Alternative Catalog Number: ABB-A3022-500UL,ABB-A3022-100UL,ABB-A3022-1000UL,ABB-A3022-20UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: ARB, BMD, BEST, RP50, VMD2, TU15B, Best1V1Delta2, BEST1

Product Description

This gene encodes a member of the bestrophin gene family. This small gene family is characterized by proteins with a highly conserved N-terminus with four to six transmembrane domains. Bestrophins may form chloride ion channels or may regulate voltage-gated L-type calcium-ion channels. Bestrophins are generally believed to form calcium-activated chloride-ion channels in epithelial cells but they have also been shown to be highly permeable to bicarbonate ion transport in retinal tissue. Mutations in this gene are responsible for juvenile-onset vitelliform macular dystrophy (VMD2), also known as Best macular dystrophy, in addition to adult-onset vitelliform macular dystrophy (AVMD) and other retinopathies. Alternative splicing results in multiple variants encoding distinct isoforms.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 68kDa
• NCBI: 7439
• UniProt: O76090
• Purity: Affinity purification
• Sequence: LEKLSLPHNMFWVPWVWFANLSMKAWLGGRIRDPILLQSLLNEMNTLRTQCGHLYAYDWISIPLVYTQVVTVAVYSFFLTCLVGRQFLNPAKAYPGHELD
• Target: BEST1
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cell Biology Developmental Biology,Cell Adhesion,Neuroscience. Shipping: Ice Bag

Images

Western blot analysis of various lysates using BEST1 Rabbit pAb (A3022) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.