BEST1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A3022
Article Name: BEST1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A3022
Supplier Catalog Number: A3022
Alternative Catalog Number: ABB-A3022-500UL,ABB-A3022-100UL,ABB-A3022-1000UL,ABB-A3022-20UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: ARB, BMD, BEST, RP50, VMD2, TU15B, Best1V1Delta2, BEST1
This gene encodes a member of the bestrophin gene family. This small gene family is characterized by proteins with a highly conserved N-terminus with four to six transmembrane domains. Bestrophins may form chloride ion channels or may regulate voltage-gated L-type calcium-ion channels. Bestrophins are generally believed to form calcium-activated chloride-ion channels in epithelial cells but they have also been shown to be highly permeable to bicarbonate ion transport in retinal tissue. Mutations in this gene are responsible for juvenile-onset vitelliform macular dystrophy (VMD2), also known as Best macular dystrophy, in addition to adult-onset vitelliform macular dystrophy (AVMD) and other retinopathies. Alternative splicing results in multiple variants encoding distinct isoforms.
Clonality: Polyclonal
Molecular Weight: 68kDa
NCBI: 7439
UniProt: O76090
Purity: Affinity purification
Sequence: LEKLSLPHNMFWVPWVWFANLSMKAWLGGRIRDPILLQSLLNEMNTLRTQCGHLYAYDWISIPLVYTQVVTVAVYSFFLTCLVGRQFLNPAKAYPGHELD
Target: BEST1
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cell Biology Developmental Biology,Cell Adhesion,Neuroscience. Shipping: Ice Bag
Western blot analysis of various lysates using BEST1 Rabbit pAb (A3022) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.