CHRNA10 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: CHRNA10 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A3042
• Supplier Catalog Number: A3042
• Alternative Catalog Number: ABB-A3042-500UL,ABB-A3042-20UL,ABB-A3042-100UL,ABB-A3042-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: CHRNA10

Product Description

Predicted to enable acetylcholine-gated cation-selective channel activity. Acts upstream of or within positive regulation of cytosolic calcium ion concentration. Predicted to be located in membrane. Predicted to be active in cholinergic synapse and neuron projection. Predicted to be integral component of postsynaptic specialization membrane.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 50kDa
• NCBI: 57053
• UniProt: Q9GZZ6
• Purity: Affinity purification
• Sequence: AEGRLALKLFRDLFANYTSALRPVADTDQTLNVTLEVTLSQIIDMDERNQVLTLYLWIRQEWTDAYLRWDPNAYGGLDAIRIPSSLVWRPDIVLYNKADAQPPGSASTNVVLRHDGAVRWDAPAITRSSCRVDVAAFPFDAQHCGLTFGSWTHGGHQLDVRPRGAAASLADFVENVEWRVLGMPARRRVLTYGCCSEPYPDVTFTLLLRRRAAAYV
• Target: CHRNA10
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:200 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human. ResearchArea: Signal Transduction,Neuroscience,Calcium Signaling,Neurodegenerative Diseases,Amyloid Plaque and Neurofibrillary Tangle Formation in Alzheimers Disease. Shipping: Ice Bag

Images

Western blot analysis of various lysates using CHRNA10 Rabbit pAb (A3042) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 20s.