Integrin alpha 6 (ITGA6/CD49f) Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: Integrin alpha 6 (ITGA6/CD49f) Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A3236
• Supplier Catalog Number: A3236
• Alternative Catalog Number: ABB-A3236-500UL,ABB-A3236-20UL,ABB-A3236-100UL,ABB-A3236-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: JEB6, CD49f, VLA-6, ITGA6A, ITGA6B, Integrin alpha 6 (ITGA6/CD49f)

Product Description

The gene encodes a member of the integrin alpha chain family of proteins. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain that function in cell surface adhesion and signaling. The encoded preproprotein is proteolytically processed to generate light and heavy chains that comprise the alpha 6 subunit. This subunit may associate with a beta 1 or beta 4 subunit to form an integrin that interacts with extracellular matrix proteins including members of the laminin family. The alpha 6 beta 4 integrin may promote tumorigenesis, while the alpha 6 beta 1 integrin may negatively regulate erbB2/HER2 signaling. Alternative splicing results in multiple transcript variants.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 127kDa
• NCBI: 3655
• UniProt: P23229
• Purity: Affinity purification
• Sequence: IDLRQKTACGAPSGICLQVKSCFEYTANPAGYNPSISIVGTLEAEKERRKSGLSSRVQFRNQGSEPKYTQELTLKRQKQKVCMEETLWLQDNIRDKLRPIPITASVEIQEP
• Target: ITGA6
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,G protein signaling,G-Protein-Coupled Receptors Signaling to MAPK Erk,PI3K-Akt Signaling Pathway,MAPK-Erk Signaling Pathway,Cell Biology Developmental Biology,Cell Adhesion,Cytoskeleton,Immunology Inflammation,CDs,Stem Cells,Embryonic Stem Cells,Hematopoietic Progenitors. Shipping: Ice Bag

Images

Western blot analysis of various lysates using Integrin alpha 6 (ITGA6/CD49f) Rabbit pAb (A3236) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.