COX8A Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A3290
Article Name: COX8A Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A3290
Supplier Catalog Number: A3290
Alternative Catalog Number: ABB-A3290-500UL,ABB-A3290-100UL,ABB-A3290-1000UL,ABB-A3290-20UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: COX, COX8, VIII, COX8L, COX8-2, VIII-L, MC4DN15, COX8A
The protein encoded by this gene is the terminal enzyme of the respiratory chain, coupling the transfer of electrons from cytochrome c to molecular oxygen, with the concomitant production of a proton electrochemical gradient across the inner mitochondrial membrane. In addition to 3 mitochondrially encoded subunits, which perform the catalytic function, the eukaryotic enzyme contains nuclear-encoded smaller subunits, ranging in number from 4 in some organisms to 10 in mammals. It has been proposed that nuclear-encoded subunits may be involved in the modulation of the catalytic function. This gene encodes one of the nuclear-encoded subunits.
Clonality: Polyclonal
Molecular Weight: 8kDa
NCBI: 1351
UniProt: P10176
Purity: Affinity purification
Sequence: MSVLTPLLLRGLTGSARRLPVPRAKIHSLPPEGKLGIMELAVGLTSCFVTFLLPAGWILSHLETYRRPE
Target: COX8A
Antibody Type: Primary Antibody
Application Dilute: WB,1:1000 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse. ResearchArea: Signal Transduction,Endocrine Metabolism,Mitochondrial metabolism,Mitochondrial markers,Neuroscience,Neurodegenerative Diseases. Shipping: Ice Bag
Western blot analysis of lysates from mouse skeletal muscle, using COX8A Rabbit pAb (A3290).