VIPAS39 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: VIPAS39 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A3479
• Supplier Catalog Number: A3479
• Alternative Catalog Number: ABB-A3479-100UL,ABB-A3479-20UL,ABB-A3479-500UL,ABB-A3479-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: SPE39, VIPAR, SPE-39, VPS16B, hSPE-39, C14orf133, VIPAS39

Product Description

Involved in endosome to lysosome transport and intracellular protein transport. Acts upstream of or within collagen metabolic process and peptidyl-lysine hydroxylation. Located in Golgi apparatus and endosome. Implicated in arthrogryposis, renal dysfunction, and cholestasis 2.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 57kDa
• NCBI: 63894
• UniProt: Q9H9C1
• Purity: Affinity purification
• Sequence: MNRTKGDEEEYWNSSKFKAFTFDDEDDELSQLKESKRAVNSLRDFVDDDDDDDLERVSWSGEPVGSISWSIRETAGNSGSTHEGREQLKSRNSFSSYAQLPKPTSTYSLSSFFRGRTRPGSFQSLSDALSDTPAKSYAPELGRPKGEYRDYSNDWSPSDTVRRLRKGKVCSLERFRSLQDKLQLLEEAVSMHDGNVITAVLIFLKRTLSKEILFRELEVR
• Target: VIPAS39
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse. Shipping: Ice Bag

Images

Western blot analysis of various lysates using VIPAS39 Rabbit pAb (A3479) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 15s.