TRMT2B Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: TRMT2B Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A3509
• Supplier Catalog Number: A3509
• Alternative Catalog Number: ABB-A3509-20UL,ABB-A3509-100UL,ABB-A3509-1000UL,ABB-A3509-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, IHC-P, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: CXorf34, dJ341D10.3, TRMT2B

Product Description

This gene encodes a homolog of the TRM2 gene in S. cerevisiae. The yeast gene encodes a tRNA methyltransferase that plays a role in tRNA maturation. The yeast protein also has endo-exonuclease activity and may be involved in DNA double strand break repair. Alternative splicing results in multiple transcripts encoding different isoforms.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 56kDa
• NCBI: 79979
• UniProt: Q96GJ1
• Purity: Affinity purification
• Sequence: MAGLKRRVPLHSLRYFISMVGLFSKPGLLPWYARNPPGWSQLFLGTVCKGDFTRVIATKCQKGQKSQKKPSHLGPLDGSWQERLADVVTPLWRLSYEEQLKVKFAAQKKILQRLESYIQMLNGVSVTTAVPKSERLSCLLHPIIPSPVINGYRNKSTFSVNRGPDGNPKTVGFYLGTWRDGNVVCVQSNHLKNIPEKHSQVAQYYEVFLRQSPLEPCLVFHEGGYWRELTVRTNSQGHTMAIITFHPQKL
• Target: TRMT2B
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:1000 - 1:2000|IHC-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Rat. ResearchArea: Epigenetics Nuclear Signaling,Cell Biology Developmental Biology. Shipping: Ice Bag

Images

Western blot analysis of various lysates using TRMT2B Rabbit pAb (A3509) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.