MYH14 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A3690
Article Name: MYH14 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A3690
Supplier Catalog Number: A3690
Alternative Catalog Number: ABB-A3690-20UL,ABB-A3690-100UL,ABB-A3690-500UL,ABB-A3690-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: DFNA4, MHC16, MYH17, PNMHH, DFNA4A, myosin, FP17425, NMHC II-C, NMHC-II-C, MYH14
This gene encodes a member of the myosin superfamily. The protein represents a conventional non-muscle myosin, it should not be confused with the unconventional myosin-14 (MYO14). Myosins are actin-dependent motor proteins with diverse functions including regulation of cytokinesis, cell motility, and cell polarity. Mutations in this gene result in one form of autosomal dominant hearing impairment. Multiple transcript variants encoding different isoforms have been found for this gene.
Clonality: Polyclonal
Molecular Weight: 228kDa
NCBI: 79784
UniProt: Q7Z406
Purity: Affinity purification
Sequence: AGKVDYKANEWLMKNMDPLNDNVAALLHQSTDRLTAEIWKDVEGIVGLEQVSSLGDGPPGGRPRRGMFRTVGQLYKESLSRLMATLSNTNPSFVRCIVPNH
Target: MYH14
Antibody Type: Primary Antibody
Application Dilute: WB,1:1000 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Rat. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cytoskeleton,Motor Proteins,Neuroscience. Shipping: Ice Bag
Western blot analysis of various lysates, using MYH14 Rabbit pAb (A3690) at 1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.