CSTB Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: CSTB Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A3815
• Supplier Catalog Number: A3815
• Alternative Catalog Number: ABB-A3815-100UL,ABB-A3815-20UL,ABB-A3815-1000UL,ABB-A3815-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: PME, ULD, CST6, EPM1, STFB, CPI-B, EPM1A, CSTB

Product Description

The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and kininogens. This gene encodes a stefin that functions as an intracellular thiol protease inhibitor. The protein is able to form a dimer stabilized by noncovalent forces, inhibiting papain and cathepsins l, h and b. The protein is thought to play a role in protecting against the proteases leaking from lysosomes. Evidence indicates that mutations in this gene are responsible for the primary defects in patients with progressive myoclonic epilepsy (EPM1). One type of mutation responsible for EPM1 is the expansion in the promoter region of this gene of a CCCCGCCCCGCG repeat from 2-3 copies to 30-78 copies.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 11kDa
• NCBI: 1476
• UniProt: P04080
• Purity: Affinity purification
• Sequence: MMCGAPSATQPATAETQHIADQVRSQLEEKENKKFPVFKAVSFKSQVVAGTNYFIKVHVGDEDFVHLRVFQSLPHENKPLTLSNYQTNKAKHDELTYF
• Target: CSTB
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Rat. ResearchArea: Epigenetics Nuclear Signaling,RNA Binding,Cell Biology Developmental Biology,Ubiquitin. Shipping: Ice Bag

Images

Western blot analysis of various lysates using CSTB Rabbit pAb (A3815) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates / proteins: 25 µg per lane.
Blocking buffer: 3 % nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time:90s.