EIF2S3 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: EIF2S3 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A3848
• Supplier Catalog Number: A3848
• Alternative Catalog Number: ABB-A3848-100UL,ABB-A3848-20UL,ABB-A3848-1000UL,ABB-A3848-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: EIF2, EIF2G, MEHMO, MRXSBRK, eIF-2gA, EIF2gamma, EIF2S3

Product Description

The protein encoded by this gene is the largest subunit of a heterotrimeric GTP-binding protein involved in the recruitment of methionyl-tRNA(i) to the 40 S ribosomal subunit.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 51kDa
• NCBI: 1968
• UniProt: P41091
• Purity: Affinity purification
• Sequence: HLAAIEIMKLKHILILQNKIDLVKESQAKEQYEQILAFVQGTVAEGAPIIPISAQLKYNIEVVCEYIVKKIPVPPRDFTSEPRLIVIRSFDVNKPGCEVDDLKGGVAGGSILKGVLKVGQEIEVRPGIVSKDSEGKLMCKPIFSKIVSLFAEHNDLQYAAPGGLIGVGTKIDPTLCRADRMVGQVLGAVGALPEIFTELEISYFLLRRLLGVRTEGDKKAAKVQKLSKNEVLMVNIGSLSTGGRVSAVKADLGKI
• Target: EIF2S3
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Rat. ResearchArea: Epigenetics Nuclear Signaling,Translation Control. Shipping: Ice Bag

Images

Western blot analysis of lysates from rat brain, using EIF2S3 Rabbit pAb (A3848) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.